SHLD2 Rabbit Polyclonal Antibody

• Catalog Number: orb583524
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SHLD2
• Target: SHLD2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM35A
• Protein Sequence: Synthetic peptide located within the following region: PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM
• UniProt ID: Q86V20
• MW: 94kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RINN2, FAM35A, FAM35A1, bA163M19.1
• Research Area: Cancer, DNA Damage
• Note: For research use only
• NCBI: NP_061927
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-FAM35A Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.