SH3GL2 monoclonal antibody (M01), clone 5A6

• Catalog Number: orb2292184
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SH3GL2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5A6
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: SH3GL2 (NP_003017, 64 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
• NCBI: NP_003017
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SH3GL2 is approximately 0.1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to SH3GL2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]

SH3GL2 monoclonal antibody (M01), clone 5A6 Western Blot analysis of SH3GL2 expression in PC-12.

Western Blot detection against Immunogen (32.45 KDa).