SH3D19 Rabbit Polyclonal Antibody

• Catalog Number: orb586743
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SH3D19
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D19
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 87kDa
• Target: SH3D19
• UniProt ID: C9JDW6
• Protein Sequence: Synthetic peptide located within the following region: RGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVN
• NCBI: NP_001009555
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: EBP, EVE1, Kryn, Eve-1, SH3P19
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: PANC1 Whole cell lysates, Antibody dilution: 1.0 ug/ml. SH3D19 is supported by BioGPS gene expression data to be expressed in PANC1.