SH3BGR Rabbit Polyclonal Antibody

SKU: orb579571

Description

Rabbit polyclonal antibody to SH3BGR

Research Area

Disease Biomarkers

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3BGR
• Target: SH3BGR
• Protein Sequence: Synthetic peptide located within the following region: CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV
• Molecular Weight: 26kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

21-GARP

WB Suggested Anti-SH3BGR Antibody Blocking: 5% Milk, Antibody dilution: 1:500, Positive Control: human LCL and mouse brains.

WB Suggested Anti-SH3BGR Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

SH3BGR

UniProt

P55822

RefSeq (Protein):NP_031367