SH2D4A Rabbit Polyclonal Antibody

• Catalog Number: orb331337
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SH2D4A
• Target: SH2D4A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SH2D4A
• Protein Sequence: Synthetic peptide located within the following region: IWKKVAEKEELEQGSRPAPTLEEEKIRSLSSSSRNIQQMLADSINRMKAY
• UniProt ID: Q9H788
• MW: 53kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ20967 antibody, anti SH2A antibody, anti P
• Research Area: Cell Biology, Immunology & Inflammation, Stem Cell
• Note: For research use only
• NCBI: NP_071354

WB Suggested Anti-SH2D4A Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.