You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290630 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant SGOL1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR |
Tested applications | ELISA, IP, WB |
Clone Number | 3C11 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH17867 |
Immunoprecipitation of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody.
SGOL1 monoclonal antibody (M01), clone 3C11. Western Blot analysis of SGOL1 expression in HeLa.
SGOL1 monoclonal antibody (M01), clone 3C11. Western Blot analysis of SGOL1 expression in PC-12.
Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody (M01), clone 3C11. Lane 1: SGOL1 transfected lysate(33.5 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (57.86 KDa).