SFTPA1/2 Antibody

• Catalog Number: orb251573
• Category: Antibodies
• Description: SFTPA1/2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Mouse, Rat, -Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By HeatWestern blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 26182 MW
• UniProt ID: Q8IWL1
• Sensitivity: > 5000 cells
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Pulmonary surfactant-associated protein A2;PSP-A;P
• Note: For research use only
• Application notes: WB: The detection limit for SFTPA1/2 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SFTPA1/2 using anti-SFTPA1/2 antibody.Lane 1:Rat Lung Tissue;2:Mouse Lung Tissue;3:A549 Cell.

IF analysis of SFTPA1/2 using anti-SFTPA1/2 antibody. SFTPA1/2 was detected in a paraffin-embedded section of rat lung tissue.

IHC analysis of SFTPA1/2 using anti-SFTPA1/2 antibody.SFTPA1/2 was detected in paraffin-embedded section of Mouse Lung Tissue.

IHC analysis of SFTPA1/2 using anti-SFTPA1/2 antibody.SFTPA1/2 was detected in paraffin-embedded section of Human Lung Cancer Tissue.

IHC analysis of SFTPA1/2 using anti-SFTPA1/2 antibody.SFTPA1/2 was detected in paraffin-embedded section of Rat Lung Tissue.

IHC analysis of SFTPA1/2 using anti-SFTPA1/2 antibody.SFTPA1/2 was detected in frozen section of Rat Lung Tissue.

IHC analysis of SFTPA1/2 using anti-SFTPA1/2 antibody.SFTPA1/2 was detected in frozen section of Mouse Lung Tissue.