Sf3b5 Rabbit Polyclonal Antibody

• Catalog Number: orb326372
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Sf3b5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sf3b5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 10kDa
• Target: Sf3b5
• UniProt ID: Q923D4
• Protein Sequence: Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN
• NCBI: NP_780311
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti 10kDa antibody, anti 1110005L13Rik antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse Thymus lysates, Antibody Dilution: 1.0 ug/mL.