SF3A1 Rabbit Polyclonal Antibody

• Catalog Number: orb577693
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SF3A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 89kDa
• Target: SF3A1
• UniProt ID: Q15459
• Protein Sequence: Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT
• NCBI: NP_005868
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PRP21, PRPF21, SAP114, SF3A120
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-SF3A1 antibody, Paraffin Embedded Tissue: Human Heart, cell Cellular Data: cardiac cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody Dilution: 2 ug/ml, Gene Name: SF3A1.

WB Suggested Anti-SF3A1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. SF3A1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.