You have no items in your shopping cart.
Cart summary
Item 1 of 1
SETMAR antibody
Catalog Number: orb330629
| Catalog Number | orb330629 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SETMAR |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SETMAR |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 59kDa |
| Target | SETMAR |
| UniProt ID | E7EN68 |
| Protein Sequence | Synthetic peptide located within the following region: FLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSY |
| NCBI | NP_001230652 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | Mar1, METNASE Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Jurkat tissue using SETMAR antibody
- Item 1 of 2
SETMAR antibody [orb382501]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 200 μl, 100 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars