SETDB1 Rabbit Polyclonal Antibody

• Catalog Number: orb576925
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SETDB1
• Target: SETDB1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SETDB1
• Protein Sequence: Synthetic peptide located within the following region: PGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCV
• UniProt ID: Q15047
• MW: 43kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ESET, KG1T, KMT1E, TDRD21, H3-K9-HMTase4
• Note: For research use only

Sample Type: HT1080 Whole cell lysates, Antibody Dilution: 1.0 ug/ml.