SERPINC1 Rabbit Polyclonal Antibody

SKU: orb578041

Description

SERPINC1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SERPINC1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human SERPINC1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cardiovascular Research

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINC1
• Target: SERPINC1
• Protein Sequence: Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AT3, AT3D, ATIII, THPH7, ATIII-R2, ATIII-T1, ATIII-T2

Immunohistochemistry with Liver tissue at an antibody concentration of 5 ug/ml using anti-SERPINC1 antibody (orb578041).

WB Suggested Anti-SERPINC1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: PANC1 cell lysate.

Quick Database Links

Gene Symbol

SERPINC1

UniProt

P01008

RefSeq (Protein):NP_000479