You have no items in your shopping cart.
Cart summary
Item 1 of 1
SERPINB9 Rabbit Polyclonal Antibody
Catalog Number: orb331414
| Catalog Number | orb331414 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SERPINB9 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Guinea pig, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SERPINB9 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 41kDa |
| Target | SERPINB9 |
| UniProt ID | P50453 |
| Protein Sequence | Synthetic peptide located within the following region: NTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTRE |
| NCBI | XP_005249241 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti SERPINB9 antibody, anti PI9 antibody, anti an Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human 721_B Whole Cell, Antibody dilution: 1 ug/ml.
- Item 1 of 1
- Item 1 of 4
- Item 1 of 3
Anti-Serpin B9 Antibody [orb214394]
IF, IH, WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl 
- Item 1 of 2
SERPINB9 Antibody [orb128714]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 25 μg, 100 μg, 200 μg
