SERPINB8 Rabbit Polyclonal Antibody

SKU: orb583720

Description

SERPINB8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SERPINB8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SERPINB8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB8
• Target: SERPINB8
• Protein Sequence: Synthetic peptide located within the following region: KAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS
• Molecular Weight: 43kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PI8, CAP2, PI-8, PSS5, C18orf53

Quick Database Links

Gene Symbol

SERPINB8

UniProt

P50452

RefSeq (Protein):NP_942130