SEPT6 Rabbit Polyclonal Antibody

SKU: orb325257

Description

SEPT6 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SEPT6. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SEPT6(septin 6). This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEPT6(septin 6)
• Target: SEPT6
• Protein Sequence: Synthetic peptide located within the following region: CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
• Molecular Weight: 50kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti KIAA0128 antibody, anti MGC16619 antibody, anti MGC20339 antibody, anti SEP2 antibody, anti SEPT2 antibody, anti RP5-876A24.2 antibody

Quick Database Links

Gene Symbol

SEPT6

UniProt

Q14141

RefSeq (Protein):NP_055944