SENP5 Rabbit Polyclonal Antibody

SKU: orb582782

Description

Rabbit polyclonal antibody to SENP5

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP5
• Target: SENP5
• Protein Sequence: Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR
• Molecular Weight: 87kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

DKFZp564O1016, FLJ42398, MGC27076

Sample Type: 1.Rat Testis cells (200 ug), Primary dilution: 1:1000, Secondary Antibody: alkaline phosphatase-conjugated anti-rabbit, Secondary dilution: 1:1000.

WB Suggested Anti-SENP5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.

Quick Database Links

Gene Symbol

SENP5

UniProt

Q96HI0

RefSeq (Protein):NP_689912