SELENOS Rabbit Polyclonal Antibody

SKU: orb325385

Description

SELENOS Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SELENOS. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SELS. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SELS
• Target: SELENOS
• Protein Sequence: Synthetic peptide located within the following region: PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AD-015 antibody, anti ADO15 antibody, anti MGC104346 antibody, anti MGC2553 antibody, anti SBBI8 antibody, anti SEPS1 antibody, anti VIMP antibody, anti SELS antibody

Quick Database Links

Gene Symbol

SELENOS

UniProt

Q9BQE4

RefSeq (Protein):NP_060915