SELENON Rabbit Polyclonal Antibody

SKU: orb580156

Description

SELENON Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SELENON. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Mouse samples and is predicted to react with Bovine, Equine, Guinea pig, Human, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: SELENON
• Protein Sequence: Synthetic peptide located within the following region: VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR
• Molecular Weight: 62kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Se, SelN, Sepn1, AI414492, 1110019I12Rik

Quick Database Links

Gene Symbol

SELENON

UniProt

D3Z5N3

RefSeq (Protein):NP_083376