Cart summary

You have no items in your shopping cart.

SDHB Rabbit Polyclonal Antibody

SKU: orb330526

Description

Rabbit polyclonal antibody to SDHB

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SDHB
TargetSDHB
Protein SequenceSynthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE
Molecular Weight32 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti IP antibody, anti PGL4 antibody, anti SDH antibody, anti SDH1 antibody, anti SDHIP antibody, anti SDH2 antibody

Similar Products

  • SDHB rabbit pAb Antibody [orb767055]

    ELISA,  IF,  IHC,  WB

    Fish, Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • SDHB antibody [C2C3], C-term [orb556185]

    ICC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • SDHB Rabbit Polyclonal Antibody [orb402230]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SDHB Rabbit Polyclonal Antibody [orb631031]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SDHB Rabbit Polyclonal Antibody [orb76232]

    IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SDHB Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

SDHB Rabbit Polyclonal Antibody

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

SDHB Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

SDHB Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

SDHB Rabbit Polyclonal Antibody

Positive control (+): Human Liver (LI), Negative control (-): Human Lung (LU), Antibody concentration: 1 ug/ml.

SDHB Rabbit Polyclonal Antibody

WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, SDHB is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002991

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SDHB Rabbit Polyclonal Antibody (orb330526)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry