Scyl3 Rabbit Polyclonal Antibody

SKU: orb326234

Description

Rabbit polyclonal antibody to Scyl3

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Scyl3
• Protein Sequence: Synthetic peptide located within the following region: NGLSDVKNTSEDNGSFPAGSNKPEEWPDWSEPEEPEQQPASIHRWPREPC
• Molecular Weight: 81kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 1200016D23Rik antibody, anti 6030457O16 antibody, anti AW214499 antibody, anti Pace1 antibody

WB Suggested Anti-Scyl3 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

Quick Database Links

Gene Symbol

Scyl3

UniProt

Q9DBQ7

RefSeq (Protein):NP_083052