SCP2 Rabbit Polyclonal Antibody

SKU: orb330861

Description

Rabbit polyclonal antibody to SCP2

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Guinea pig, Mouse, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCP2
• Target: SCP2
• Protein Sequence: Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686C12188 antibody, anti DKFZp686D11188 antibody, anti NLTP antibody, anti NSL-TP antibody, anti SCPX antibody, anti SCP-2 antibody, anti SCP-X antibody, anti SCP-CHI antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-SCP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

SCP2

UniProt

Q6NXF4

RefSeq (Protein):NP_001007099