SCN3B Rabbit Polyclonal Antibody

SKU: orb576382

Description

Rabbit polyclonal antibody to SCN3B

Research Area

Cell Biology, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCN3B
• Target: SCN3B
• Protein Sequence: Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
• Molecular Weight: 24kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SCNB3, ATFB16, BRGDA7, HSA243396

Sample Tissue: Human DLD1, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human fetal heart (HE), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.

WB Suggested Anti-SCN3B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain.

Quick Database Links

Gene Symbol

SCN3B

UniProt

Q9NY72

RefSeq (Protein):NP_060870