SART3 Rabbit Polyclonal Antibody

SKU: orb330040

Description

Rabbit polyclonal antibody to SART3

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SART3
• Target: SART3
• Protein Sequence: Synthetic peptide located within the following region: LSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLR
• Molecular Weight: 110kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti KIAA0156 antibody, anti MGC138188 antibody, anti RP11-13G14 antibody, anti TIP110 antibody, anti p110(nrb) antibody, anti P100 antibody, anti p110 antibody, anti DSAP1 antibody

WB Suggested Anti-SART3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate, SART3 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells.

Quick Database Links

Gene Symbol

SART3

UniProt

Q15020

RefSeq (Protein):NP_055521