SART3 Rabbit Polyclonal Antibody

• Catalog Number: orb330039
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SART3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SART3
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 40kDa
• Target: SART3
• UniProt ID: Q15020
• Protein Sequence: Synthetic peptide located within the following region: TSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWD
• NCBI: AAK69347
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti P100 antibody, anti p110 antibody, anti DSAP1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Liver

WB Suggested Anti-SART3 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, SART3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.