Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 38-40 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $28.00

Need Help?

Ask a Question Support@biorbyt.com

SARS-CoV-2 trimeric soluble full-length Spike protein, Delta variant, S protein

Catalog Number: orb864240

Product Overview
Product Name SARS-CoV-2 trimeric soluble full-length Spike protein, Delta variant, S protein
Catalog Number orb864240
ReactivityVirus
ConjugationUnconjugated
Tested applicationsELISA, SDS-PAGE
Sequence 16-1211
Endotoxins Less than 0.1 ng/µg (1 IEU/µg), as measured by LAL method.
Target SARS-CoV-2
Alternative Names
Product Properties
Form/Appearance Liquid: PBS 20% Glycerol
Storage The protein should be stored at -20°C to -70°C preferably in small aliquots to avoid repeated freeze-thaw cycles.
Tag 8xHis at the C terminus.
Note For research use only.
Protein Sequence VNLRTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGT TLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLDVYYHKNNKSWMESGVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKI YSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPL SETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLND LCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNG VEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDA VRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGA GICASYQTQTNSRRGAGSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCT QLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSPIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQK FNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGPALQIPFPMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTPSALGK LQNVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRV DFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIV NNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKGSGSGYIPEAPRDGQ AYVRKDGEWVLLSTFLGSGHHHHHHHH
Purity >90% as estimated by SDS-PAGE stained with Instant Blue Stain (Abcam).
MW 190 kDa
Source HEK293
Uniprot ID P0DTC2
Product Description

Recombinant human SARS-CoV-2 trimeric soluble full-length Spike protein, Delta variant, S protein

Validation Images
SARS-CoV-2 trimeric soluble full-length Spike protein, Delta variant, S protein
SARS-CoV-2 trimeric soluble full-length Spike protein, Delta variant, S protein
Reviews
Write Your Own Review
You're reviewing:SARS-CoV-2 trimeric soluble full-length Spike protein, Delta variant, S protein - orb864240
Your Rating