SAA4 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292213
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human SAA4 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SAA4 (NP_006503.1, 1 a.a. ~ 130 a.a) full-length human protein.
• Protein Sequence: MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_006503.1

SAA4 MaxPab rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.

Western Blot analysis of SAA4 expression in transfected 293T cell line by SAA4 MaxPab polyclonal antibody. Lane 1: SAA4 transfected lysate (14.80 KDa). Lane 2: Non-transfected lysate.