You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SAA4 Rabbit Polyclonal Antibody
Catalog Number: orb578417
| Catalog Number | orb578417 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to SAA4 |
| Target | SAA4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Guinea pig, Mouse, Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SAA4 |
| Protein Sequence | Synthetic peptide located within the following region: RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK |
| UniProt ID | P35542 |
| MW | 2kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | CSAA, C-SAA |
| Note | For research use only |
| NCBI | NP_006503 |
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 3 ug/ml.
WB Suggested Anti-SAA4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Stomach.
- Item 1 of 2
SAA4 purified MaxPab rabbit polyclonal antibody (D01P) [orb2292213]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 2
Anti-SAA4 Antibody [orb668027]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
