S1PR2 Rabbit Polyclonal Antibody

SKU: orb331298

Description

Rabbit polyclonal antibody to S1PR2

Research Area

Cancer Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human S1PR2
• Target: S1PR2
• Protein Sequence: Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE
• Molecular Weight: 38kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti AGR16 antibody, anti EDG-5 antibody, anti EDG5 antibody, anti Gpcr13 antibody, anti H218 antibody, anti LPB2 antibody, anti S1P2 antibody

Sample Type: COLO205 Whole Cell lysates, Antibody dilution: 1.0 ug/ml.

Quick Database Links

Gene Symbol

S1PR2

UniProt

O95136

RefSeq (Protein):NP_004221