S100A6 Rabbit Polyclonal Antibody

SKU: orb326119

Description

Rabbit polyclonal antibody to S10A6

Research Area

Cancer Biology, Cell Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human S10A6
• Target: S100A6
• Protein Sequence: Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN
• Molecular Weight: 9kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti S100A6 antibody, anti CACY antibody, anti antibody

Sample Type: Lung Tumor lysates, Antibody Dilution: 1.0 ug/mL.

Quick Database Links

Gene Symbol

S100A6

UniProt

P06703

RefSeq (Protein):NP_055439