S100A10 Rabbit Polyclonal Antibody

• Catalog Number: orb585738
• Category: Antibodies
• Description: Rabbit polyclonal antibody to S100A10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 11kDa
• Target: S100A10
• UniProt ID: P60903
• Protein Sequence: Synthetic peptide located within the following region: DPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
• NCBI: NP_002957
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 42C, P11, p10, GP11, ANX2L, CAL1L, CLP11, Ca[1], A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human PC-3 Whole Cell, Antibody dilution: 5 ug/ml.

WB Suggested Anti-S100A10 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.