You have no items in your shopping cart.
Page Not Found
Cart summary
Item 1 of 1
RXFP4 Rabbit Polyclonal Antibody
Catalog Number: orb586092
| Catalog Number | orb586092 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RXFP4 |
| Target | RXFP4 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Porcine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: RDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG |
| UniProt ID | Q8TDU9 |
| MW | 41kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GPR100, RLN3R2, RXFPR4, GPCR142 |
| Note | For research use only |
| NCBI | NP_871001 |
WB Suggested Anti-RXFP4 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.
- Item 1 of 2
GPR100 Rabbit Polyclonal Antibody [orb157292]
FC, IF, IHC-Fr, IHC-P
Bovine, Mouse, Porcine, Rabbit
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 3
- Item 1 of 1
