You have no items in your shopping cart.
Cart summary
RuvC Protein, E. coli, Recombinant (His & SUMO)
Catalog Number: orb1979313
| Catalog Number | orb1979313 |
|---|---|
| Category | Proteins |
| Description | Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group. |
| Tag | N-6xHis-SUMO |
| Protein Sequence | AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR |
| UniProt ID | P0A814 |
| MW | 34.6 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Expression Region | 2-173 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
