You have no items in your shopping cart.
Cart summary
RuvC Protein, Akkermansia muciniphila, Recombinant (His & Myc)
Catalog Number: orb1979866
| Catalog Number | orb1979866 |
|---|---|
| Category | Proteins |
| Description | Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group. RuvC Protein, Akkermansia muciniphila, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.2 kDa and the accession number is B2UP63. |
| Tag | N-10xHis, C-Myc |
| Protein Sequence | MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI |
| UniProt ID | B2UP63 |
| MW | 23.2 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Akkermansia muciniphila |
| Expression Region | 1-167 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
