You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291490 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human RUVBL2 protein. |
Species/Host | Mouse |
Clonality | Polyclonal |
Tested applications | IF, WB |
Reactivity | Human |
Immunogen | RUVBL2 (NP_006657.1, 1 a.a. ~ 463 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS |
NCBI | NP_006657.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunofluorescence of purified MaxPab antibody to RUVBL2 on HeLa cell. [antibody concentration 10 ug/ml]
RUVBL2 MaxPab polyclonal antibody. Western Blot analysis of RUVBL2 expression in HeLa.
RUVBL2 MaxPab polyclonal antibody. Western Blot analysis of RUVBL2 expression in human pancreas.
Western Blot analysis of RUVBL2 expression in transfected 293T cell line by RUVBL2 MaxPab polyclonal antibody. Lane 1: RUVBL2 transfected lysate(50.93 KDa). Lane 2: Non-transfected lysate.