RTL10 Antibody

• Catalog Number: orb614134
• Category: Antibodies
• Description: RTL10 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: "Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human"
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 36-39 kDa
• UniProt ID: Q7L3V2
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Protein Bop; BH3-only protein; Retrotransposon Gag
• Note: For research use only
• Application notes: "Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users." . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-RTL10 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of HL-60 cells using anti-RTL10 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

WB analysis using anti-RTL10 antibody.Lane 1:placenta tissue, Lane 2:A431 cell, Lane 3:HL-60 cell, Lane 4:U2OS cell, Lane 5:PC-3 cell, Lane 6:rat lung tissue, Lane 7:mouse HEPA1-6 cell.