You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb614134 |
---|---|
Category | Antibodies |
Description | RTL10 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | "Western blot, 0.25-0.5μg/ml, Human, Mouse, Rat Flow Cytometry, 1-3μg/1x106 cells, Human" |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 36-39 kDa |
UniProt ID | Q7L3V2 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Protein Bop; BH3-only protein; Retrotransposon Gag Read more... |
Note | For research use only |
Application notes | "Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users." . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of PC-3 cells using anti-RTL10 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.
Flow Cytometry analysis of HL-60 cells using anti-RTL10 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.
WB analysis using anti-RTL10 antibody.Lane 1:placenta tissue, Lane 2:A431 cell, Lane 3:HL-60 cell, Lane 4:U2OS cell, Lane 5:PC-3 cell, Lane 6:rat lung tissue, Lane 7:mouse HEPA1-6 cell.
Filter by Rating