RSRC1 Rabbit Polyclonal Antibody

• Catalog Number: orb586891
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RSRC1
• Target: RSRC1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RSRC1
• Protein Sequence: Synthetic peptide located within the following region: SRTYSRKKGGRKSRSKSRSWSRDLQPRSHSYDRRRRHRSSSSSSYGSRRK
• UniProt ID: Q96IZ7
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MRT70, BM-011, SFRS21, SRrp53
• Note: For research use only
• NCBI: NP_057709

Sample Type: 721_B Whole cell lysates, Antibody dilution: 1.0 ug/ml. RSRC1 is supported by BioGPS gene expression data to be expressed in 721_B.