Rrp7a Rabbit Polyclonal Antibody

• Catalog Number: orb577788
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rrp7a
• Target: Rrp7a
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rrp7a
• Protein Sequence: Synthetic peptide located within the following region: KERRKRARKELLSFYAWQHRETKMEHLAQLRKKFEEDKQRIELMRAQRKF
• UniProt ID: D4AE65
• MW: 30kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Cgi-96, RGD1311547
• Note: For research use only
• NCBI: NP_001124040

Sample Type: Rat Spleen lysates, Antibody Dilution: 1.0 ug/ml.