RRP1B Rabbit Polyclonal Antibody

SKU: orb579591

Description

Rabbit polyclonal antibody to RRP1B

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RRP1B
• Target: RRP1B
• Protein Sequence: Synthetic peptide located within the following region: VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP
• Molecular Weight: 84kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Nnp1, RRP1, NNP1L, KIAA0179, PPP1R136

WB Suggested Anti-RRP1B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. RRP1B is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

WB Suggested Anti-RRP1B Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: human LCL.

Quick Database Links

Gene Symbol

RRP1B

UniProt

Q14684

RefSeq (Protein):NP_055871