RRP15 Rabbit Polyclonal Antibody

SKU: orb587064

Description

Rabbit polyclonal antibody to RRP15

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRP15
• Target: RRP15
• Protein Sequence: Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD
• Molecular Weight: 31 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CGI-115, KIAA0507

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by sumoylation and other modifications that influence it's mobility.

Sample Type: A549 Whole cell lysates, Antibody dilution: 1.0 ug/ml. RRP15 is supported by BioGPS gene expression data to be expressed in A549.

Quick Database Links

Gene Symbol

RRP15

UniProt

Q9Y3B9

RefSeq (Protein):NP_057136