RPS4Y1 Rabbit Polyclonal Antibody

SKU: orb585272

Description

RPS4Y1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting RPS4Y1. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology, Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: RPS4Y1
• Protein Sequence: Synthetic peptide located within the following region: LGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISL
• Molecular Weight: 29kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

S4, RPS4Y

Quick Database Links

Gene Symbol

RPS4Y1

UniProt

P22090

RefSeq (Protein):NP_000999