Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RPS3 Rabbit Polyclonal Antibody

SKU: orb585742

Description

RPS3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting RPS3. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetRPS3
Protein SequenceSynthetic peptide located within the following region: RRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVN
Molecular Weight27kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

S3

Similar Products

  • RPS3 Rabbit Polyclonal Antibody [orb443217]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Ribosomal Protein S3 rabbit pAb Antibody [orb766248]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • RPS3 Rabbit Polyclonal Antibody [orb100206]

    WB

    Rat, Xenopus, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • RPS3 Rabbit Polyclonal Antibody [orb630847]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • RPS3 Rabbit Polyclonal Antibody [orb630848]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RPS3 Rabbit Polyclonal Antibody

Lanes: 1: Maduca sexta intestine lysate-untreated, 2: Maduca sexta intestine lysate-2 hour crytoxin, 3: Maduca sexta intestine lysate-4 hour crytoxin, 4: Maduca sexta intestine lysate-6 hour crytoxin, 5: Maduca sexta intestine lysate-12 hour crytoxin, 6: Maduca sexta intestine lysate-24 hour crytoxin, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: RPS3.

RPS3 Rabbit Polyclonal Antibody

WB Suggested Anti-RPS3 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell. RPS3 is supported by BioGPS gene expression data to be expressed in A549.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000996

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RPS3 Rabbit Polyclonal Antibody (orb585742)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry