RPL5 Rabbit Polyclonal Antibody

• Catalog Number: orb583012
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPL5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPL5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 34kDa
• Target: RPL5
• UniProt ID: P46777
• Protein Sequence: Synthetic peptide located within the following region: RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP
• NCBI: NP_000960
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: L5, uL18, MSTP030, PPP1R135
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Arabidopsis thaliana extract (30 ug), Primary Diltution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:15000, Exposure Time: 1 minute.

WB Suggested Anti-RPL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.