RPL32 Rabbit Polyclonal Antibody

• Catalog Number: orb324834
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPL32
• Target: RPL32
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPL32
• Protein Sequence: Synthetic peptide located within the following region: AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKG
• UniProt ID: P62910
• MW: 15kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti L32 antibody, anti PP9932 antibody
• Note: For research use only
• NCBI: NP_000985

WB Suggested Anti-RPL32 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.