RPL26 Rabbit Polyclonal Antibody

SKU: orb585064

Description

RPL26 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting RPL26. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Neuroscience, Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: RPL26
• Protein Sequence: Synthetic peptide located within the following region: TVHVGIHPSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETIEKM
• Molecular Weight: 16kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

L26, DBA11

Quick Database Links

Gene Symbol

RPL26

UniProt

P61254

RefSeq (Protein):NP_000978