RPL24 Rabbit Polyclonal Antibody

• Catalog Number: orb327194
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPL24
• Target: RPL24
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPL24
• Protein Sequence: Synthetic peptide located within the following region: FLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQR
• UniProt ID: P83731
• MW: 18 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti RPL24 antibody, anti antibody
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_000977

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 0.8 ug/mL of the antibody was used in this experiment. Protein may be modified by phosphorylation.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.