RPL19 monoclonal antibody (M01), clone 3H4

• Catalog Number: orb2292248
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RPL19.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3H4
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2a Lambda
• Immunogen: RPL19 (NP_000972, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLARRKGRHMGIGKRKGTANARMPEKVTWMRRMR
• NCBI: NP_000972
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RPL19 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to RPL19 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. [antibody concentration 1 ~ 10 ug/ml]

RPL19 monoclonal antibody (M01), clone 3H4 Western Blot analysis of RPL19 expression in HeLa.

RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Jurkat.

RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in NIH/3T3.

RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in PC-12.

RPL19 monoclonal antibody (M01), clone 3H4. Western Blot analysis of RPL19 expression in Raw 264.7.

Western Blot analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4. Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).