RPA1 Rabbit Polyclonal Antibody

• Catalog Number: orb583203
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RPA1
• Target: RPA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA1
• Protein Sequence: Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA
• UniProt ID: P27694
• MW: 68kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HSSB, RF-A, RP-A, REPA1, RPA70, MST075
• Note: For research use only
• NCBI: NP_002936

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. RPA1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RPA1 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. RPA1 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-RPA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.