RORA Rabbit Polyclonal Antibody

• Catalog Number: orb333114
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RORA
• Target: RORA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORA
• Protein Sequence: Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA
• UniProt ID: P35398
• MW: 63kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ROR1 antibody, anti ROR2 antibody, anti ROR3
• Note: For research use only
• NCBI: NP_599022

Human kidney

WB Suggested Anti-RORA Antibody Titration: 4.0 ug/ml, Positive Control: HepG2 cell lysate.