RNF2 monoclonal antibody (M01), clone 6C2

• Catalog Number: orb2292261
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6C2
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: RNF2 (NP_009143, 192 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
• NCBI: NP_009143
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RNF2 is approximately 0.03 ng/ml as a capture antibody.

RNF2 monoclonal antibody (M01), clone 6C2 Western Blot analysis of RNF2 expression in NIH/3T3.

RNF2 monoclonal antibody (M01), clone 6C2. Western Blot analysis of RNF2 expression in Raw 264.7.

Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M01), clone 6C2. Lane 1: RNF2 transfected lysate (37.7 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody (M01), clone 6C2 (Cat # orb2292261). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).