RNF2 Rabbit Polyclonal Antibody

• Catalog Number: orb575018
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RNF2
• Target: RNF2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNF2
• Protein Sequence: Synthetic peptide located within the following region: LVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGE
• UniProt ID: Q5TEN1
• MW: 29kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BAP1, DING, BAP-1, HIPI3, RING2, RING1B
• Research Area: Epigenetics & Chromatin, Protein Biochemistry, Ste
• Note: For research use only
• NCBI: NP_009143

Human kidney

WB Suggested Anti-RNF2 antibody Titration: 1 ug/ml, Sample Type: Human Heart.

WB Suggested Anti-RNF2 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.

WB Suggested Anti-RNF2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.